General Information

  • ID:  hor005281
  • Uniprot ID:  P41335
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Erinaceus europaeus (Western European hedgehog)
  • Family:  NPY family
  • Source:  animal
  • Expression:  pancreas
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Erinaceus (genus), Erinaceinae (subfamily), Erinaceidae (family), Eulipotyphla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VPLEPVYPGDNATPEQMAHYAAELRRYINMLTRPRY
  • Length:  36
  • Propeptide:  VPLEPVYPGDNATPEQMAHYAAELRRYINMLTRPRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41335-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P41335-F1.pdbhor005281_AF2.pdbhor005281_ESM.pdb

Physical Information

Mass: 485829 Formula: C189H291N53O54S2
Absent amino acids: CFKSW Common amino acids: P
pI: 7.52 Basic residues: 5
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: -70.56 Boman Index: -7737
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70.56
Instability Index: 7746.39 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  8234904
  • Title:  The primary structure of pancreatic polypeptide from a primitive insectivorous mammal, the European hedgehog (Erinaceous europaeus).